PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.112050.1
Common NameCsa_1G029570, LOC101214705
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 234aa    MW: 26703.6 Da    PI: 8.8402
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.112050.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.2e-18449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+++G+++W++Ia++++ gR++k+c++rw++ 
   Cucsa.112050.1  4 RGHWRPAEDEKLRELVERYGPHNWNAIAQKLQ-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding52.11.5e-165699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r ++T+eE+e+l   ++ +G++ W+ Iar ++ gRt++ +k++w+ 
   Cucsa.112050.1 56 RTPFTEEEEERLMASHRVHGNR-WAIIARLFP-GRTDNAVKNHWHV 99
                     679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.942154IPR017930Myb domain
SMARTSM007173.6E-15352IPR001005SANT/Myb domain
PfamPF002497.0E-18449IPR001005SANT/Myb domain
SuperFamilySSF466898.61E-30497IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-27557IPR009057Homeodomain-like
CDDcd001671.00E-13748No hitNo description
PROSITE profilePS5129421.06355105IPR017930Myb domain
SMARTSM007175.4E-1455103IPR001005SANT/Myb domain
PfamPF002491.9E-135698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2058103IPR009057Homeodomain-like
CDDcd001673.05E-105898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MCSRGHWRPA EDEKLRELVE RYGPHNWNAI AQKLQGRSGK SCRLRWFNQL DPRINRTPFT  60
EEEEERLMAS HRVHGNRWAI IARLFPGRTD NAVKNHWHVI MARRSRNKSK TQTLTQTLTQ  120
THNNNNNNNN RLLLSSFLQL HAYPTSNISF IPKPPPDDAA AAAAAHSSCS IIHYYDFLQV  180
NSTDSMNGSE VIDNSSRKED YEEVNNNNNG EQQAVLLPFI DFFSASSNNT SIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C7e-3411041104C-Myb DNA-Binding Domain
1msf_C7e-3411041104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455801.11e-145PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0A0LPV01e-142A0A0A0LPV0_CUCSA; Uncharacterized protein
STRINGPOPTR_0012s03650.12e-85(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-75myb domain protein 52
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]